"Horeca sprendimai" is one of the leading animal by products and used vegetable oil collecting company in Lithuania. We can provide big quantities fats. Used mainly from restaurantsm hotels, fast food cafe\'s supermarkets. ...

We are100% of European Company. Established in 2010, started with waste vegetable oil collection and processing Baltics, now have facility Estonia. But as times had past, we developed diversified into new activities are also doing export International ...

Demi Tech is an swedish company specialized in wholesale of oils, fats and chemical products for food- and chemical industries manufacturers.www.demitechab.se

Agro-Top is a considerable business partner in the field of animal fats with production capacity 25 000 mt per year.Years experience sourcing, melting, and use have made us an expert our branch.Our mission to keep leader position on Polish fat market. We want ...

MBP Industry and Product Focus focuses on servicing the Food Pharma industries as well Oleochemical industry (including biodiesel) where common denominator is raw material of Biological origin. We service these by handling adding value to their ...

wddkhfeikncwoihiwhiinifknidsancidnirenkvniriwidekfmfnfjfjfjfjfkdddmdmjejejenemelldkfjffnremememjfjfjfjmnfnrerjekjkfkfmrfnrenrejf

Our company (Palesse-invest, Belsrus) sells baked food fats of an animal origin: pork, beef, technical (made in Belarus).

Master247 is a trading company based in Sydney Australia. We are highly focused and committed to assisting Foreign companies connect with quality Australian commodity products by providing professional service, peace of mind value for customers ...

our company produce and supply many grades of tallow(beef fats, sheep fats pig etc.), the top grade tallow can be edible other used to cosmetic animal feed, soap, fatty acid chemical additives, we also according buyer\'s index requirement.moreover, kinds ...

JRT Services started as a transportation broker in the soil business both contaminated and clean New Jersey surrounding states. JRT has evolved into buying selling any type of marketable products worldwide. 2011 environmental products, fuel reducing ...

We have been supplying the foodservice industry in Quebec and Ontario provinces for over 35 years. Our Spectra, Golden Alfa brands become synonymous with incomparable quality, exceptional reliability outstanding value that has put us forefront of our ...

Milantre Grupp is a trading company in the field of fertilizers and animal by-products. Our products are renowned for high digestibility purity. exported by-products include:MEAT AND BONE MEAL (MBM); FISH MEAL; OIL; BLOOD ANIMAL FATS. ...

Moorgate Proteins Ltd supplies a range of quality protein products, including meat and bone meal, feather meal, fish meal, porcine meal, blood meal, fats and oil.

We can supply large scale volumes of sugar and have good competitive prices. We are not so much interested in low volumes, minimum 25, 000 metric tons per month sugar--"ICUMSA 45" is the standard around world what we mainly sell, but provide brown ...

We are SCK Import & Export company., wwith its main function to help source and supply our clients overseas in purchasing variety of food products, especially Fresh/Frozen meat, Edible oils, Beverages Seafoods Products. Today, we able export numerous ...